A jar contains 6 blue gumballs, 4 yellow gumballs, and 8 red gumballs. What is the probability of choosing a yellow gumball and then a red gumball if the first gumball is placed back into the jar before the second is chosen?

Answers

Answer 1

Answer:

2/9 or 22.22% and 4/9 or 44.44%

Step-by-step explanation:

6+4+8=18   4/18=2/9   8/18=4/9


Related Questions

LMNP is a rectangle. Find the value of x and the length of each diagonal.

Answers

The value of x is equal to 3.

The length of diagonal LN is equal to 18 units.

The length of diagonal MP is equal to 15 units.

What is a diagonal?

In Mathematics, the diagonal of a rectangle can be defined as a line segment that connects any two (2) of its non-adjacent vertices together while dividing the rectangle into two (2) equal parts.

This ultimately implies that, the length of each diagonal of a rectangle is always equal to each other. Therefore, the diagonals of any rectangle is always equal to one other.

How to determine the value of x?

We would determine the value of x by equating the length of each diagonal as follows;

LN = MP

7x - 3 = 4x + 3.

7x - 4x = 3 + 3

3x = 6

x = 6/2

x = 3.

Next, we would calculate length of each diagonal as follows;

LN = 7x - 3

LN = 7(3) - 3

LN = 21 - 3

LN = 18 units.

MP = 4x + 3.

MP = 4(3) + 3.

MP = 12 + 3

MP = 15 units.

Read more on rectangle here: https://brainly.com/question/17117320

#SPJ1

Complete Question:

LMNP is a rectangle. Find the value of x and the length of each diagonal.

LN = 7x - 3 and MP = 4x + 3.

Find the perimeter of the polygon.
S cm
6 cm
6 cm
8 cm
a. 25 cm
b. 20 cm
C. 30 cm
d. 28 cm
Please select the best answer from the choices provided
Ο Α

Answers

Answer:

A. 25 cm

Step-by-step explanation:

Perimeter of a polygon = the sum of all sides of the polygon

Therefore,

Perimeter of the given polygon = 5 + 6 + 8 + 6

Perimeter = 25 cm

Find the area. The figure is not drawn to scale.

Find the volume of the sphere shown. Give each answer rounded to the nearest cubic unit.

Answers

Answer:

[tex](a)\ Area = 28.12cm^2[/tex]

[tex](b)\ Volume = 1437.33cm^3[/tex]

Step-by-step explanation:

Solving (a): The parallelogram

[tex]h = 7.6[/tex] --- height

[tex]b = 3.7[/tex] --- base

The area is calculated usng:

[tex]Area = base * Height[/tex]

[tex]Area = 3.7 * 7.6[/tex]

[tex]Area = 28.12cm^2[/tex]

Solving (b): The sphere

[tex]d = 14cm[/tex]

Required

The volume

First, calculate the radius

[tex]r = d/2[/tex]

[tex]r = 14cm/2 = 7c,[/tex]

The volume is calculated using:

[tex]Volume = \frac{4}{3} \pi r^3[/tex]

This gives:

[tex]Volume = \frac{4}{3} * \frac{22}{7} * 7^3[/tex]

[tex]Volume = \frac{4}{3} * 22 * 7^2[/tex]

[tex]Volume = \frac{4}{3} * 1078[/tex]

[tex]Volume = \frac{4*1078}{3}[/tex]

[tex]Volume = \frac{4312}{3}[/tex]

[tex]Volume = 1437.33[/tex]

WILL MARK BRAINLIEST!

Calculate mF in parallelogram FGDE.

Answers

answer to this question would be d :)

y=(x+3)(x-2)(x-r) with a y int. of 24. solve for r?

Answers

Answer:

Step-by-step explanation:

To solve for r, you need to first find the values of x that make y equal to 24. These values of x are called the roots of the polynomial equation y = (x+3)(x-2)(x-r).

To find the roots of the equation, you can use the quadratic formula:

x = (-b +/- sqrt(b^2 - 4ac)) / (2a)

where a, b, and c are the coefficients of the quadratic equation y = ax^2 + bx + c.

In this case, the coefficients are:

a = 1

b = -3

c = -24

Substituting these values into the quadratic formula, we get:

x = (3 +/- sqrt(9 - 96)) / 2

= (3 +/- sqrt(-87)) / 2

Since sqrt(-87) is not a real number, there are no real roots for this equation. Therefore, the value of r cannot be determined.

Help! Cant figure out math question!

Answers

x = - 0.09
x = 1.76

Are the two possible values for X

10 gallons 4 quarts = ____ quarts

Please help

Answers

Answer:40 quarts
10•4=40

What is the axis of symmetry for a parabola expressed by the quadratic equation? y=x^2+10x-25

Answers

Answer:

the axis of symmetry is: x=-5

Write an explicit formula for An, the nth term of the sequence 16, -8,4, ....

Answers

Answer:16(-1/2)^n-1

Step-by-step explanation:

4. The profit on one share is Rs20.What is the profit on 5000 shares?

Answers

Answer:

The profit is: [tex]Rs100000[/tex]

Step-by-step explanation:

Given

[tex]1 \to Rs20[/tex]

Required

Profit on 5000

Repesent this as: x

So, we have:

[tex]1 \to Rs20[/tex]

[tex]5000 \to x[/tex]

Cross Multiply

[tex]x * 1 = Rs20 * 5000[/tex]

[tex]x * 1 = Rs100000[/tex]

The profit is: [tex]Rs100000[/tex]

20. You are buying new car for $24,320. You must put down 17%. How much will you need to finance the car for?

Answers

17 percent of 24320 is 4134.4

basically minus that

so

24320 - 4134.4 = 20,185.60

Answer:

24320 - 4134.4 = 20,185.60

Step-by-step explanation:

:)

Round 0.265625 to the nearest hundredth

Answers

Answer:

0.27 is the answer

I wish you luck in your assignments.

Answer:

Step-by-step explanation:

0.27

b) Express of 8000 cm³ of milk as a percentage of 16 litres of milk​

Answers

Answer:

50%

Step-by-step explanation:

16 litres = (16 x 1000) cm^3

             = 16000 cm^3

Hence,

Percentage = 8000/16000 x 100%

                    = 1/2 x 100%

                    = 50%

Order from least to greatest √_220 , -10, √_100 , 11.5

Answers

Answer: -10, √_100, 11.5, √_220

Step-by-step explanation:

-10 is the least bc it just is and √_100 simplified is 10 and 11.5 is a little greater so duh and √_220 simplified is 14.83

without using a calculator
cos² 43° - sin² 74° + cos² 47 - Sin16°​

Answers

Answer:

100

Step-by-step explanation:

because if you add it all up you will find the sum

mark is thinking of two numbers
his two numbers have a positive sum but a negative product
give an example of what hi numbers could be ?

Answers

9514 1404 393

Answer:

  -2, 3

Step-by-step explanation:

For the product to be negative, exactly one of the two numbers must be negative. For the sum to be positive, the positive number must be larger than the absolute value of the negative number.

One such pair of numbers is -2 and 3.

__

Their product is -6; their sum is +1.

100 POINTSSSSS!!!!!!!!!!!!!!!!!

What is the solution to the equation 1 over 5 multiplied by n equals 3 ? (5 points)

n = 8
n = 15
n = 25
n = 125

Answers

Answer:

n=15

Step-by-step explanation:

Answer:

n = 15

Step-by-step explanation:

1/5 * 15 = 3

This is 100% correct, if you don't believe me go to a new tab and type 1/5*15

It will say 3.

Find the sum of all solutions to the equation $4x(x-3) = 23$.
I NEED THIS ASAP

Answers

The sum of the solutions of the equation 4x(x - 3) = 23 is 3.

What is a quadratic equaton?

A quadratic equation is an algebraic expression in the form of variables and constants.

A quadratic equation has two roots as its degree is two.

Given, An equation 4x(x - 3) = 23.

Now, Distributing the terms in the LHS we have,

4x² - 12x = 23.

4x² - 12x - 23 = 0.

By applying Sridhar acharya's formula we have,

[tex]x_{1,\:2}=\frac{-\left(-12\right)\pm \sqrt{\left(-12\right)^2-4\cdot \:4\left(-23\right)}}{2\cdot \:4}[/tex].

[tex]x=\frac{3+4\sqrt{2}}{2},\:x=\frac{3-4\sqrt{2}}{2}[/tex].

Therefore, The sum of the solutions of the equation is,

x + x = (3 + 4√2)/2 + (3 - 4√2)/2.

= (3 + 4√2 + 3 - 4√2)/2.

= 6/2.

= 3.

learn more about quadratic equations here :

https://brainly.com/question/30098550

#SPJ1

In ΔNOP, the measure of ∠P=90°, the measure of ∠N=26°, and OP = 13 feet. Find the length of PN to the nearest tenth of a foot.

Answers

Answer:

b

Step-by-step explanation:

Given:
f(x) = x² + x − 6
g(x) = x + 3
Find: (f/g)(x)

Answers

Answer:

x–2, x ≠ -3

Step-by-step explanation:

Solution in the diagram

PLEASE HELP ME! There are 2 Images below!!!

Answers

Answer:

A

Step-by-step explanation:

The slop formula is [tex]\frac{rise}{run}[/tex] and in the first one the rise increase per y (x) is 2 units and the run (y) is 1 as we calculated the run as how many units x rises per y and A is the answer due to it being the one which follows the rule.

What is a remainder

Answers

I think you spelt it wrong

A remainder is the remaining amount of a number than comes out of a division. I'm not sure how to explain it better, so I'll give you an example:

Let's say you want to divide 5 by 2. We know that 5 can't be divided by 2 evenly, it won't give you a whole number. Instead it will give you a decimal 2.5.

In this case, 1 is the remainder and I will explain why! Do the long division for 5/2. 2 fits into 5 two times, so you multiply 2 * 2, which gives you 4. If you subtract that number from 5, you get 1. We know that 2 can't fit into one, therefore, 1 is the remainder. once you start getting into decimals, you can fit numbers into other numbers, which is why technically you can fit 2 into 5, but you can't fit it in evenly, if that makes sense!

I hope this example helps see what a remainder is. It's just the number in a long division that the divisor (in my example, 2 is the divisor) can't fit in!

Half of the class of 40 students are absent. How many students are absent today?​

Answers

Answer:

20 students were absent

Step-by-step explanation:

Half means divide by 2:

40/2 = 20

if you earn 3250 over the 10 year period, how much will be in the account at the end of the 10 year period?

Answers

If earning 3250 per month over 10year period, At the end of 10th year, the amount on the account will be 390,000

What is multiplication?

To multiply means to add equal groups. When we multiply, the number of things in the group increases. The two factors and the product are parts of a multiplication problem. In the multiplication problem, 6 × 9 = 54, the numbers 6 and 9 are the factors, while the number 54 is the product.

The amount earned In a month is 3250.

There are 12 months In a year.

The total month in 10 years = 10× 12 = 120 months

The total amount in the account for 10years = 120×3250 = 390,000

Therefore there will be 390000 in the account at the end of 10th year.

learn more about multiplication from

https://brainly.com/question/10873737

#SPJ1

Please help on both!!!!!

Answers

Answer:

[tex]14\pi[/tex] and [tex]16\pi[/tex]

Step-by-step explanation:

The equation for the circumference of circles is either [tex]d\pi[/tex] or [tex]2r\pi[/tex], with r being the radius and d being the diameter.

Question A

The diameter is stated as 14. Plug into the equation to get:

[tex]14\pi[/tex]

This is your answer in exact form.

Question B

The radius is stated as 8. Plug into the equation to get:

[tex]2(8)\pi[/tex]

[tex]16\pi[/tex]

This is your answer in exact form.

Answer:

1) 43.98

2) 50.27

Step-by-step explanation:

I hope this helps!

Exponential Functions

Determine which of the following exponential formula(s) represents exponential function II in the graph above.
(a) 10(1.2)t (β) 10(1.5)t
(x) 20(1.2)t (8) 30(0.85)t
(8) 30(0.95)t (∅) 30(1.05)t

a. x c. 8
b. a d. ∅

Please select the best answer from the choices provided

Answers

Answer:

A. x

Step-by-step explanation:

I calculated it logically

Please explain step by step I dont get it.

Answers

Every 84 points they will get 7 coins so find the graph that plots that.

NO LINKS!!!



A researcher found the average cost of one and two-bedroom apartments for different cities and graphed the data in a scatter plot, with costs of one-bedroom apartments along the x-axis. The variables have a strong linear correlation and the equation for the regression line is yˆ=1.182x+19.096 .

Based on the equation, what should the researcher expect for the average cost of a two-bedroom apartment in a city where the average cost of a one-bedroom apartment is $815?

Answers

Answer:

i hope it helps mapriend

The weight of the square is 10 grams. How much heavier is the circle than the square?

Answers

The weight of the circle is heavier than the weight of the square by the weight of the triangle

How to find how much weightier is the circle as compared with the square

Examining the weights, can lead to a linear equation, the equation will have the follows parameters

let t represent triangle

let c represent circle

let s represent square

6s + 3t = 3s + 3c

6s - 3s + 3t = 3s + 3c

3s + 3t = 3c

divide through by 3

s + t = c

10 + t = c

From the equation 10 + t = c we can say that the weight of the circle is a triangle weight more than the square

Learn more about equations at:

https://brainly.com/question/22688504

#SPJ1

3y+2=2x is this a direct variation

Answers

The equation 3y + 2 = 2x is not a direct variation

How to determine if the equation is a direct variation

From the question, we have the following parameters that can be used in our computation:

Variation = direct variation

3y + 2 = 2x

A direct variation is represented as

y = kx

Where k is the constant of proportion

When the equations y = kx and  3y + 2 = 2x are compared, we can see that

The equation 3y + 2 = 2x has a constant term

Hence, the equation is not a direct variation

Read more about variation at

https://brainly.com/question/11177292

#SPJ1

Other Questions
How could the matter in a piece of rock at the top of a mountain eventually be incorporated into volcanic lava? Write a short essay showing how the atmosphere, hydrosphere, cryosphere, geosphere, and biosphere are involved in this process. Put the continuum of force in order from least to greatest force: A. Verbal Officer + Presence + Lethal + Empty Hand + Less LethalB. Less Lethal + Empty Hand + Lethal + Verbal + Officer PresenceC. Officer Presence + Verbal + Empty Hand + Less Lethal + Lethal what is 9.5 is what % of 50 i have a test tomorrow 1/11/23 and I dont understand it PPPLSSSSSS HELPPPPPP ILL GIVE BRAINLYEST Study the following list of words. Find all of the words that relate to being QUIET. Use your dictionary or thesaurus if you are not sure of a word's meaning.jumpcrawlboomcreepsplashjangleyellspeedyskipdartfleeshoutbarkloiterhotswiftcracksilencesleepskimpeacecalmimmovablesoftlysoundlessturtledashrapidstillelegantlaghushroarmurmursnailzoom The lesson of the story is Never giveup!" What else might the author add tothe lesson of the story? Find the lope-intercept equation of the line that pae through (1,-3) and ha a lope of -1/4 What is the main idea of Geographical Landforms ? Can someone please help I need the answers please!!!!!!!!!!!! What are the 4 main purposes of text? The majority of thread Meister customers live outside of cities in colder climates Write a procedure ConvertToBinary that takes an input as a number from 0 to 16 (including 0 but not 16) and converts it to a binary number. The binary number should be returned as a list. A ________________ helps you "see" the previous frame and helps keep the movement of the video consistent. overlay appframes per secondhaunted framesonion skinghost skin Dan drank 7/8 of a bottle of water During basketball practice. He then drank Another 4/8 of a bottle after practice. How much water did he drink altogether thats The Night is a big black catThe Moon is her topaz eye,The stars are the mice she hunts at night,In the field of the sultry skyIdentify a metaphor from the poem In a storeroom,there are 30 blue balls,48 green balls,some red balls and some white balls. there are 3 times as many green balls as red balls and 5 times as many blue balls as white balls.(a) How many balls are there altogether?(b) How many balls are left in the room if 7/10 (fraction) of the balls are taken away?pls help me answer both You've been asked to write an article for your school newspaper about the pros and cons of homework. What is ironic about this conversation the attorney thinks that there might be valuable evidence in the kitchen while? portia in act 3 is seen to be a typical women of the Elizabethan era. justify Which of the following best describes the beliefs of the Radical Republicans after the Civil War? They worked to pardon all former Confederate leaders. They supported President Johnson without question. They wanted to give former slaves equal rights. They planned to return Southern land back to white owners. How is the text structured in this passage from the prologue sugar changed the world?